PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g020288m
Common NameCISIN_1g020288mg, LOC102611718
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family Dof
Protein Properties Length: 329aa    MW: 35209.1 Da    PI: 8.8704
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g020288mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.63.1e-3977134562
             zf-Dof   5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                         lkcprCdstntkfCy+nnyslsqPr+fCkaCrryWt+GGalrnvPvGgg+r+nkks+
  orange1.1g020288m  77 PLKCPRCDSTNTKFCYFNNYSLSQPRHFCKACRRYWTRGGALRNVPVGGGCRRNKKSK 134
                        689****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-3358130IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.70278132IPR003851Zinc finger, Dof-type
PfamPF027015.1E-3378132IPR003851Zinc finger, Dof-type
PROSITE patternPS01361080116IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003002Biological Processregionalization
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009611Biological Processresponse to wounding
GO:0009625Biological Processresponse to insect
GO:0009753Biological Processresponse to jasmonic acid
GO:0010439Biological Processregulation of glucosinolate biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MVFSSVPVYL DPPNWHHQQP NHQQGAGSEN PHQLPPIPSA PHHVVGVGGA PGGAGSIRPG  60
SMADRARLAK IPHTEVPLKC PRCDSTNTKF CYFNNYSLSQ PRHFCKACRR YWTRGGALRN  120
VPVGGGCRRN KKSKSSSSSS KSPANNTEKL QQMGNSNSTS SLPPEIIGHL QQQCNTPHQI  180
PLMPSLHNLS QYNMGSIGLN FGGIGASSGV GSSHSTDHVG FQIGSNSSMS SSAILSAGGG  240
VQQFTFFEPP NTGLYSFQAE GIEAPSSLVV ASNPRVSEQA PAKMEDHHQE LNLSRPFFGI  300
SENNQYWSGN NWTDLSALNN STSTNHLL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006424805.10.0hypothetical protein CICLE_v10028829mg
RefseqXP_006488303.10.0PREDICTED: dof zinc finger protein DOF2.2
TrEMBLA0A067FZV10.0A0A067FZV1_CITSI; Uncharacterized protein
TrEMBLV4SGS70.0V4SGS7_9R
STRINGPOPTR_0001s24540.11e-115(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17132886
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07640.23e-50Dof family protein